Cat: IPD-X20323

Recombinant Human Fc gamma RIIIA/CD16a Protein(HEK293), Avi & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Fc gamma RIIIA/CD16a

  • 简介

    Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-Avi, C-His labeled tag and F176V mutation.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Low affinity immunoglobulin gamma Fc region receptor III-A; FcRIIIa; FcR-10; CD16a; FCGR3A; IGFR3

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Avi;C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08637

  • Expression Region

    G17-Q208, F176V

  • AA Sequence

    MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    46 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fc gamma RIIIA (CD16a) is a crucial receptor expressed on the surface of natural killer (NK) cells and some immune cell types, playing a significant role in mediating antibody-dependent cellular cytotoxicity (ADCC). This receptor binds to the Fc region of IgG antibodies, facilitating the immune system's ability to target and eliminate infected or malignant cells. Due to its critical role in immune response, CD16a has attracted considerable attention in immunotherapy, particularly in the development of monoclonal antibodies for cancer treatment. Researchers have been investigating the structure and function of recombinant CD16a proteins to better understand its binding affinities, signaling mechanisms, and potential modifications that could enhance its therapeutic efficacy. Studies have shown that optimizing the glycosylation patterns of CD16a can improve its interaction with antibodies, thus enhancing immune response. Additionally, recombinant CD16a proteins serve as valuable tools in clinical studies and drug development, allowing scientists to explore their use in combination therapies that harness the power of the immune system to combat tumors. The growing body of research surrounding Fc gamma RIIIA/CD16a underscores its potential as a target for novel immunotherapeutic strategies, aiming to improve patient outcomes in cancer and infectious diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US