Recombinant Cynomolgus Fc gamma RIIIA/CD16a Protein(HEK293), His

Fc gamma RIIIA/CD16a

The FcγRIIIA/CD16a protein is a receptor for IgG and is optimally activated upon binding of aggregated antigen-IgG complexes, inducing antibody-dependent cellular cytotoxicity (ADCC). It mediates IgG effector function on natural killer cells, limiting viral load. Fc gamma RIII/CD16 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

1. Measured by its binding ability in a SPR assay (Biacore T200). Rituximab captured on CM5 Chip via Protein A can bind Cynomolgus Fc gamma RIII with an affinity constant of 0.251 μM. 2. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED50 for this effect is 0.276 μg/mL, corresponding to a specific activity is 3.62×10^3 Unit/mg. Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED50 for this effect is 0.276 μg/mL, corresponding to a specific activity is 3.62×103 Unit/mg.

IgG Fc receptor III; Fc-gamma RIII; FcRIII; FCGR3; CD16; CD16A; FCG3; FcgRIII; FCR-10; FCRIIIA; IGFR3; IMD20

Cynomolgus

HEK293

C-His

Greater than 90% as determined by SDS-PAGE.

Q8SPW2

G17-Q208

GMRAEDLPKAVVFLEPQWYRVLEKDRVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ

Extracellular Domain

33-40 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.