Analytical Data
-
Gene name
CA125
-
简介
CA125 is a giant mucin-like glycoprotein expressed by epithelial ovarian neoplasms and cells, which is an antigenic tumor marker. CA125 provides a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. CA125 binds to mesothelin (MSLN) mediates heterotypic cell adhesion, contributing to the metastasis of ovarian cancer to the peritoneum by initiating cell attachment to the mesothelial epithelium. CA125 is widely used for monitoring with ovarian epithelial cancer. CA125 Protein, Human (HEK293, His) is a recombinant human cancer antigen 125 (CA125) with a His label and is expressed in HEK293 cells[1][2][3][4][5][6][7].
- Application
-
Biological Activity
1. Immobilized Human Mesothelin (HY-P700426) at 10 μg/mL (100 μl/well) can bind recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His).The ED50 of recombinant Human CA125, His (HEK293-expressed) (rHuCA125, His) is ≤2 μg/mL. 2. Immobilized Recombinant Human MPF (HY-P70413) Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg. Immobilized Recombinant Human MSLN/Mesothelin Protein at 2 μg/mL (100 μl/well) can bind Biotinylated Recombinant Human CA125 Protein. The ED50 for this effect is 5.731 ng/mL, corresponding to a specific activity is 1.74×105 Unit/mg.
-
Alternative Names
rHuCA125, His; CA125 ovarian cancer antigen; CA125; CA125MUC-16;
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WXI7
-
Expression Region
G12660-M12923
-
AA Sequence
GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGMHHHHHH
-
Protein Length
Partial
-
Molecular Weight
40-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CA125, also known as MUC16, is a mucin glycoprotein primarily expressed on the surface of ovarian carcinoma cells and is widely recognized as a tumor marker for ovarian cancer. The elevation of CA125 levels in the serum is often associated with the presence of ovarian tumors, making it a valuable tool for diagnosis, monitoring treatment response, and assessing prognosis. However, CA125 is not exclusively specific to ovarian cancer, as it can also be elevated in various benign conditions, which limits its utility as a standalone diagnostic marker. The development of recombinant CA125 protein has garnered attention in research for its potential applications in improving diagnostic accuracy and developing therapeutic strategies. Researchers have focused on producing recombinant CA125 to better understand its structure and functions, and to develop more precise diagnostic tests and immunotherapies. Furthermore, investigations into the glycosylation patterns of CA125 may provide insights into its biological behavior and the tumor microenvironment. By utilizing recombinant technology, scientists aim to overcome the limitations associated with traditional serological assays and explore novel avenues for early detection and targeted treatment of ovarian cancer. This ongoing research holds promise for enhancing the clinical management of ovarian cancer patients and improving outcomes through more effective use of CA125 as a biomarker.
