Cat: IPD-X20275

Recombinant Rhesus Macaque CD5 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD5

  • 简介

    CD5 Protein lacks conserved residue(s) essential for feature annotation propagation. CD5 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CD5 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized Zymosan at 200 μg/mL (100 μL/well) can bind Biotinylated CD5. The ED50 for this effect is 1.68 μg/mL, corresponding to a specific activity is 595.24 Unit/mg. Measured by its binding ability in a functional ELISA. Immobilized Zymosan at 200 μg/mL (100 μL/well) can bind Biotinylated CD5. The ED50 for this effect is 1.68 μg/mL, corresponding to a specific activity is 595.24 Unit/mg.

  • Alternative Names

    CD5 molecule; CD5; LEU1; T1; CD5 antigen

  • Species

    Rhesus Macaque

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    F6V5Q9

  • Expression Region

    R25-P375

  • AA Sequence

    RLSWDDPDFQTRLTRSNSRCQGQLEVYIKYGWHMVCSQSWGRSSNQWEDPNQASKVCQRLNCGVPLSLGPFLITDRHQSQITCYGRLGSFSNCSHSGRDVCRPLGLTCLEPQTTTPPPTRPPPTTTPEPTAPPRLQLVAQAAGRHCAGVVEFYSGSLGGTISYEAQDKAQDKTQVLENFLCSSLQCGSFLKHLPETEAATAQDPGELREHQPLPIQWTIRNSSCTSLEHCFQKIKPRNSGQVLALLCSGFQPKVQSRLVGSSICEGTVEVRQGAQWAALCDSSSAKSSLRWEEVCREQQCGSFNSYQALDAGDPTSRGLSCPHQKLSQCHELTERKSYCKKVFVTCQDPNP

  • Protein Length

    Partial

  • Molecular Weight

    41.81 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD5 is a type I transmembrane glycoprotein that plays a crucial role in modulating T cell and B cell functions within the immune system. It is primarily expressed on the surface of T lymphocytes and certain B cells, influencing their activation and survival. The study of CD5 has gained significant attention due to its contribution to immune responses and its potential implications in various diseases, particularly autoimmune disorders and cancers. Scientists have focused on the role of CD5 in enhancing T cell receptor (TCR) signaling and its interaction with other co-stimulatory molecules, which can alter immune cell behavior. Recombinant CD5 proteins have been developed for research purposes to investigate their biochemical properties and therapeutic potentials. These studies aim to uncover how CD5 modulation can be harnessed to improve immune responses in vaccine development or to develop novel treatments for cancers where CD5 is overexpressed or dysfunctional. As a result, understanding the structure and function of recombinant CD5 proteins may pave the way for innovative strategies in immunotherapy and the management of immune-related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US