Analytical Data
-
Gene name
IL-2Rb
-
简介
IL-2R beta (CD122), a type Ⅰ cytokine receptor expressed on T lymphocytes, is a receptor for IL-2 (Kd: 1 nM approximately)[1]. IL-2R beta mediates T cell immune responses, such as stimulating T cell proliferation and activating lymphokine-activated killer cells[2]. IL-2R beta/CD122 Protein, Mouse (P.pastoris, His) is a recombinant mouse IL-2R beta (27A-240E) with a N-Terminal His tag, which is produced in P.pastoris.
- Application
-
Alternative Names
Il2rbInterleukin-2 receptor subunit beta; IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; High affinity IL-2 receptor subunit beta; p70-75; CD antigen CD122
-
Species
Mouse
-
Source
P. pastoris
-
Tag
N-6*His
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
P16297
-
Expression Region
A27-E240
-
AA Sequence
AVKNCSHLECFYNSRANVSCMWSHEEALNVTTCHVHAKSNLRHWNKTCELTLVRQASWACNLILGSFPESQSLTSVDLLDINVVCWEEKGWRRVKTCDFHPFDNLRLVAPHSLQVLHIDTQRCNISWKVSQVSHYIEPYLEFEARRRLLGHSWEDASVLSLKQRQQWLFLEMLIPSTSYEVQVRVKAQRNNTGTWSPWSQPLTFRTRPADPMKE
-
Protein Length
Extracellular Domain
-
Molecular Weight
27.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Related Products
Protein Description
Interleukin-2 receptor beta (IL-2Rb) is a critical component of the interleukin-2 (IL-2) signaling pathway, which plays a vital role in the regulation of immune responses, particularly T cell proliferation and differentiation. The IL-2Rb subunit forms part of the high-affinity IL-2 receptor complex, alongside the alpha (IL-2Ra) and gamma (IL-2Rg) chains. Impairments or mutations in IL-2Rb can lead to severe immunological disorders, such as Combined Immunodeficiency syndrome (SCID), highlighting its importance in maintaining immune system functionality. The recombinant production of IL-2Rb protein is essential for understanding its structure, function, and interactions within the receptor complex. With advancements in recombinant DNA technology, researchers have been able to express and purify IL-2Rb, facilitating studies into its molecular mechanisms. Additionally, understanding IL-2Rb interactions aids in the development of therapeutic strategies targeting autoimmune diseases and enhancing cancer immunotherapy. Thus, the study of IL-2Rb recombinant protein is crucial for elucidating its role in immune regulation and developing novel clinical applications.








