Cat: IPD-X22034

Recombinant Human CD276/B7-H3 CD276/B7-H3 (4Ig)/B7-H3b Protein(HEK293), hFc & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD276/B7-H3 CD276/B7-H3 (4Ig)/B7-H3b

  • 简介

    CD276/B7-H3 protein can regulate T cell-mediated immune responses and act as a protective factor for tumor cells by inhibiting natural killer-mediated cell lysis. It also functions as a neuroblastoma cell marker, plays a role in acute and chronic transplant rejection, and modulates lymphocyte activity at mucosal surfaces. CD276/B7-H3 (4Ig)/B7-H3b Protein, Human (217a.a, HEK293, Myc-hFc) is the recombinant human-derived CD276/B7-H3 protein, expressed by HEK293 , with C-Myc, C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3;

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-Myc;C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5ZPR3-1

  • Expression Region

    L29-G245

  • AA Sequence

    LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

  • Protein Length

    Partial

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD276, also known as B7-H3, is a member of the B7 family of immune checkpoint proteins that plays a crucial role in modulating immune responses. It is expressed on various immune and non-immune cells and is implicated in both promoting and inhibiting immune responses depending on the context. CD276 has garnered significant interest in cancer immunotherapy due to its aberrant expression in numerous malignancies, where it can contribute to tumor immune evasion. The identification of CD276/B7-H3 (4Ig) isoform, which possesses an extended extracellular region, adds complexity to its functional repertoire. Research has shown that this isoform may have distinct roles in tumor progression and immune modulation compared to the conventional B7-H3. Moreover, the development of recombinant B7-H3b proteins for therapeutic applications has the potential to harness its immunosuppressive functions to enhance anti-tumor immunity. Understanding the structural and functional characteristics of CD276/B7-H3 and its isoforms is crucial for developing targeted therapies that can manipulate the immune system to fight cancer more effectively. This makes the study of CD276/B7-H3 proteins not only an important area of cancer research but also a promising avenue for innovative immunotherapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US