Analytical Data
-
Gene name
Fc gamma RIIB/CD32b
-
简介
Fc gamma RIIB/CD32b Protein plays a crucial role, specifically binding to the Fc region of immunoglobulins gamma as a low-affinity receptor. Binding to IgG, it initiates cellular responses against pathogens, highlighting its immune system modulation. Interactions with FGR and LYN underscore its role in signaling pathways, emphasizing its significance in mediating cellular responses and contributing to immune defense against diverse antigens. Fc gamma RIIB/CD32b Protein, Rat (HEK293, His) is the recombinant rat-derived Fc gamma RIIB/CD32b protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.3838 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized Rat CD32b, at 2 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.3838 μg/mL.
-
Alternative Names
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-b; IgG Fc Receptor II-b; CDw32; FcRII-b; CD32; FCGR2B; FCG2; IGFR2
-
Species
Rat
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q63203
-
Expression Region
H32-P212
-
AA Sequence
HAGLPKAVVKLEPPWIQVLKEDTVTLMCEGTHNTKNCSTQWFHNGSSIWHQAQANYTFKATVNDSGEYRCRMEETGISEPIHLGVISDWLLLQTSQLVFEEGETITLRCHSWKNKQLTKVLLFQNGKPVRYYHQSSNFSIPKANHSHSGNYYCKAYLGRTMHVSKPVTITVQEPKSSSSLP
-
Protein Length
Extracellular Domain
-
Molecular Weight
30-50 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fc gamma RIIB (CD32b) is an inhibitory receptor for the Fc region of immunoglobulin G (IgG), playing a crucial role in regulating immune responses. It is predominantly expressed on B cells, dendritic cells, and macrophages, where it mediates negative signaling that dampens the activation and proliferation of immune cells. Understanding the role of Fc gamma RIIB is vital for insights into various immune-mediated diseases, including autoimmune disorders, allergies, and cancer. The receptor has emerged as a potential therapeutic target due to its ability to modulate immune responses. Research into recombinant forms of Fc gamma RIIB/CD32b aims to elucidate its structural properties and functional mechanisms, enabling the development of novel therapies that could enhance or inhibit immune responses in a targeted manner. By investigating the interactions between Fc gamma RIIB and its ligands, scientists hope to uncover new strategies to manipulate immune activity for clinical purposes, such as improving vaccine efficacy or preventing tissue damage in autoimmune conditions. The recombinant proteins enable detailed studies of the receptor's signaling pathways and interactions, providing critical knowledge that could lead to innovative immunotherapies and contribute to our understanding of immune regulation.











