Cat: IPD-X21797

Recombinant Human Fc gamma RIIA/CD32a Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Fc gamma RIIA/CD32a

  • 简介

    Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (H167R, HEK293, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-6*His labeled tag and H167R mutation.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human IgG1 protein. The ED50 for this effect is 0.7182 μg/mL, corresponding to a specific activity is 1.39×10^3 Unit/mg. Immobilized Human CD32a at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG1. The ED50 for this effect is 0.7182 μg/mL, corresponding to a specific activity is 1.39×103 Unit/mg.

  • Alternative Names

    Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a; IgG Fc receptor II-a; CDw32; Fc-Gamma RII-a; Fc-Gamma-RIIa; FcRII-a; CD32; FCGR2A; CD32; FCG2; FCGR2A1; IGFR2

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P12318-1

  • Expression Region

    A36-I218, H167R

  • AA Sequence

    AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI

  • Protein Length

    Partial

  • Molecular Weight

    27-32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fc gamma RIIA, also known as CD32a, is an important receptor in the Fc gamma receptor family, which plays a crucial role in the immune response by mediating the functions of immunoglobulin G (IgG) antibodies. This receptor is primarily expressed on myeloid cells, including macrophages, monocytes, and neutrophils, and is involved in various immune processes such as phagocytosis, antibody-dependent cellular cytotoxicity (ADCC), and the regulation of inflammatory responses. Research on Fc gamma RIIA/CD32a has gained significant attention due to its potential implications in autoimmune diseases, infectious diseases, and cancer. Notably, polymorphisms in the CD32a gene can affect the receptor's affinity for IgG, influencing individual responses to infections and therapies, particularly monoclonal antibodies. The recombinant form of this protein is of great interest for both basic research and therapeutic applications, as it allows for the detailed study of receptor function, ligand interactions, and the development of new immunotherapies. Understanding the structure and dynamics of Fc gamma RIIA/CD32a can pave the way for innovative strategies to enhance immune responses against pathogens or tumors and improve the efficacy of antibody-based treatments. Therefore, the generation and characterization of recombinant Fc gamma RIIA/CD32a protein is a vital step in unraveling its biological functions and therapeutic potential in various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US