Analytical Data
-
Gene name
IL-3R alpha/CD123
-
简介
IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.
- Application
-
Alternative Names
Interleukin-3 receptor subunit alpha; IL-3R-alpha; IL-3RA; CD123; Sut-1
-
Species
Mouse
-
Source
HEK293
-
Tag
C-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26952-1
-
Expression Region
S17-K331
-
AA Sequence
SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK
-
Protein Length
Extracellular Domain
-
Molecular Weight
50-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-3 receptor alpha (IL-3Rα), also known as CD123, is a crucial component of the IL-3 receptor complex, which plays a significant role in hematopoiesis and immune regulation. Expressed on various hematopoietic cells, including stem cells and progenitor cells, IL-3Rα facilitates the binding of interleukin-3 (IL-3), a key cytokine that promotes cell proliferation, survival, and differentiation. Increased expression of CD123 has been observed in several hematological malignancies, such as acute myeloid leukemia (AML) and other leukemias, making it an attractive target for therapeutic interventions. The development of recombinant IL-3Rα/CD123 proteins holds promise for enabling new strategies in cancer treatment, particularly through targeted therapies such as monoclonal antibodies and chimeric antigen receptor (CAR) T-cell therapies. Research focusing on the structural and functional characterization of IL-3Rα/CD123 recombinant protein seeks to enhance understanding of its role in cellular signaling and to identify potential therapeutic targets. Additionally, the generation of high-purity recombinant proteins can facilitate the development of diagnostic tools and treatment options that could improve patient outcomes in diseases associated with aberrant IL-3 signaling. Investigating the molecular interactions and pathways involving IL-3Rα will contribute further to the field of immunotherapy and potentially lead to novel interventions for hematological cancers and other disorders linked to IL-3 dysregulation.











