Recombinant Human Fc gamma RIIIA/CD16a Protein(HEK293), Avi & His

Fc gamma RIIIA/CD16a

Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (F176V, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by HEK293 , with C-Avi, C-His labeled tag and F176V mutation.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Low affinity immunoglobulin gamma Fc region receptor III-A; FcRIIIa; FcR-10; CD16a; FCGR3A; IGFR3

Human

HEK293

C-Avi;C-His

Greater than 90% as determined by SDS-PAGE.

P08637

G17-Q208, F176V

MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ

Extracellular Domain

46 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.