Analytical Data
-
Gene name
FGL2
-
简介
FGL2 is a key enzyme in the coagulation cascade and plays a key role in the conversion of prothrombin to thrombin, reflecting its important contribution to hemostasis and coagulation processes. Structurally, FGL2 forms homotetramers characterized by disulfide bonds that contribute to its functional integrity and catalytic activity in the complex process of thrombin generation. FGL2 Protein, Mouse (HEK293, His-Avi, Flag) is the recombinant mouse-derived FGL2 protein, expressed by HEK293 , with C-Avi, N-His, N-Flag labeled tag.
- Application
-
Biological Activity
Immobilized Mouse FGL2, His Tag at 5μg/mL (100μL/well) can bind anti-FGL2 Antibody, The ED50 for this effect is 5.068 ng/mL. Immobilized Mouse FGL2, His Tag at 5 μg/mL (100 μL/well) can bind anti-FGL2 Antibody, The ED50 for this effect is 5.068 ng/mL.
-
Alternative Names
Fibroleukin; pT49; FGL2; fibrinogen-like 2;
-
Species
Mouse
-
Source
HEK293
-
Tag
C-Avi;N-His;N-Flag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P12804
-
Expression Region
P197-P432
-
AA Sequence
PVQHLIYKDCSDHYVLGRRSSGAYRVTPDHRNSSFEVYCDMETMGGGWTVLQARLDGSTNFTREWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYALYDQFYVANEFLKYRLHIGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDSCLSANLNGKYYHQKYKGVRNGIFWGTWPGINQAQPGGYKSSFKQAKMMIRPKNFKP
-
Protein Length
Partial
-
Molecular Weight
40-50 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FGL2, or fibrinogen-like protein 2, is a member of the fibrinogen-related protein family that has gained attention in the research community due to its significant role in immune regulation and potential implications in various diseases, particularly in cancer and autoimmune disorders. Originally identified as a product of activated T cells, FGL2 is involved in modulating immune responses by interacting with specific receptors, thereby influencing the activity of immune cells such as T cells and macrophages. The understanding of FGL2’s structure and function has led to investigations into its role as a potential biomarker for disease progression and therapeutic target. Research has indicated that FGL2 may promote tumor growth and metastasis in certain cancers by creating an immunosuppressive environment, complicating the host's immune response against tumors. Moreover, its involvement in regulating cytokine production and the balance between Th1 and Th2 responses highlights its importance in maintaining immune homeostasis. Recombining FGL2 into a soluble form for further study has enabled scientists to explore its mechanisms of action in greater detail, paving the way for the development of innovative therapeutic strategies aimed at modulating immune responses. Understanding the biological functions and therapeutic potential of FGL2 could lead to breakthrough advancements in treating various pathologies, underscoring the significance of this protein in both basic and applied biomedical research.
