Cat: IPD-X21657

Recombinant Rat B7-H4 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B7-H4

  • 简介

    The B7-H4 protein acts as a negative regulator, inhibiting T cell activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells (Tregs) to suppress tumor-associated antigen-specific T cell immunity and create an immunosuppressive microenvironment. B7-H4 Protein, Rat (HEK293, His) is the recombinant rat-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED50 for this effect is 0.9752 μg/mL in the presence of 5μg/mL anti-CD3, corresponding to a specific activity is 1.025×103 U/mg. Measured by its ability to inhibit anti-CD3 antibody induced IL-2 secretion by human T cells. The ED50 for this effect is 0.9752 μg/mL in the presence of 5μg/mL anti-CD3, corresponding to a specific activity is 1.025×103 U/mg.

  • Alternative Names

    V-set domain containing T-cell activation inhibitor 1; VTCN1; Protein B7S1; B7-H4

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q501W4

  • Expression Region

    F29-S256

  • AA Sequence

    FGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIHTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLELLNS

  • Protein Length

    Partial

  • Molecular Weight

    42-65 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B7-H4 is an immune checkpoint protein that belongs to the B7 family of molecules, which play a crucial role in regulating T-cell responses and maintaining immune tolerance. Research into B7-H4 has gained prominence due to its implications in cancer immunotherapy and autoimmunity. It is primarily expressed in various tumor tissues and has been associated with poor prognosis in several cancers, indicating its potential role as an inhibitory receptor that dampens anti-tumor immune responses. The identification of B7-H4 as a negative regulator of T-cell activation has prompted scientists to explore its recombinant protein form for therapeutic applications, including the development of monoclonal antibodies aimed at blocking its interaction with receptors on T-cells. This therapeutic strategy could enhance immune responses against tumors, making it a promising avenue in cancer treatment. Furthermore, understanding the structural and functional dynamics of B7-H4 through the study of its recombinant protein can provide valuable insights into its mechanism of action and its interactions with other immune modulators, ultimately leading to more effective strategies in harnessing the immune system for cancer therapy. The ongoing research also seeks to clarify its role in other diseases, particularly autoimmune disorders, where modulation of B7-H4 could restore immune balance. Overall, the investigation of B7-H4 recombinants not only holds potential for cancer immunotherapy but also enhances our understanding of immune regulation, paving the way for innovative treatments that could improve patient outcomes in a variety of diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US