Cat: IPD-X19644

Recombinant Rat SLAMF2/CD48 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SLAMF2/CD48

  • 简介

    SLAMF2/CD48 is a GPI-anchored glycoprotein that regulates immune cells. It interacts with receptors like CD2 and CD244/2B4, activating LCK and LAT in T-cell signaling. SLAMF2 also phosphorylates CD244, leading to immunological synapse formation and targeted release of cytolytic granules by T-lymphocytes and NK-cells. Its direct interactions with CD2, CD244, and LCK contribute to immune response regulation. SLAMF2/CD48 Protein, Rat (HEK293, His) is the recombinant rat-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. Immobilized 2B4/CD244 at 5μg/mL (100μL/well) can bind Rat SLAMF2. The ED50 for this effect is 2.78 μg/mL. Measured by its binding ability in a functional ELISA. Immobilized 2B4/CD244 at 5μg/mL (100μL/well) can bind Rat SLAMF2. The ED50 for this effect is 2.78 μg/mL.

  • Alternative Names

    CD48 antigen; SLAMF2; TCT.1; CD48; BCM1; BLAST1

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P10252

  • Expression Region

    F23-R216

  • AA Sequence

    FQDQSVPNVNAITGSNVTLTILKHPLASYQRLTWLHTTNQKILEYFPNGKKTVFESVFKDRVDLDKTNGALRIYNVSKEDRGDYYMRMLHETEDQWKITMEVYDLVSKPAIKIEKTKNLTDSCHLRLSCKVEDQGVDYTWYEDSGPFPQRNPGYVLEITITPHNKSTFYTCQVSNPVSSENDTLYFIPPCTLAR

  • Protein Length

    Partial

  • Molecular Weight

    32-50 kDa 32-50 kDa in SDS-PAGE under reducing conditions.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SLAMF2, also known as CD48, is a crucial member of the SLAM (Signaling Lymphocyte Activation Molecule) family of proteins, which play significant roles in immune responses and cell signaling. The CD48 protein is primarily expressed on immune cells, including T cells, B cells, and natural killer (NK) cells, and acts as a co-stimulatory molecule that influences the activation, differentiation, and function of these cells. Research on SLAMF2/CD48 has gained attention due to its involvement in various immune disorders, infectious diseases, and cancers. Understanding the structure and function of SLAMF2/CD48 is essential for developing potential therapeutic strategies, as modulation of its activity may enhance immune responses or suppress aberrant ones. The generation of recombinant SLAMF2/CD48 proteins facilitates detailed studies of its interactions with ligands and receptors, as well as its signaling pathways. This research is pivotal in elucidating the mechanisms underlying immune regulation and could lead to novel immunotherapeutic approaches for boosting antitumor immunity or treating autoimmune diseases. Thus, the study of SLAMF2/CD48 recombinant proteins not only provides insights into fundamental immunological processes but also holds promise for advancing clinical applications in immunology and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US