Cat: IPD-X19574

Recombinant Rat CD38 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD38

  • 简介

    CD38 protein plays diverse roles, synthesizing key second messengers: cyclic ADP-ribose (cADPR) for glucose-induced insulin secretion and nicotinate-adenine dinucleotide phosphate (NAADP) as a calcium mobilizer.Its cADPR hydrolase activity adds to its versatility.Notably, CD38 also regulates osteoclastic bone resorption, likely by producing cADPR and initiating a calcium ion signal through ryanodine receptor activation.CD38 Protein, Rat (HEK293, His) is the recombinant rat-derived CD38 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rRtADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1, His ; 17-1A; 323/A3; ACSTD1; CD326; EGP-2; EGP314; EGP40; EpCAM; MOC31; TACST-1; TACSTD1; TROP1;

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q64244

  • Expression Region

    W45-V303

  • AA Sequence

    WPRSPLVWKGKPTTKHFADIILGRCLIYTQILRPEMRDQDCKKILSTFKRGFISKNPCNITNEDYAPLVKLVTQTIPCNKTLFWSKSKHLAHQYTWIQGKMFTLEDTLLGYIADDLRWCGDPSTSDMNYDSCPHWSENCPNNPVAVFWNVISQKFAEDACGVVQVMLNGSLSEPFYRNSTFGSVEVFNLDPNKVHKLQAWVMHDIKGTSSNACSSPSINELKSIVNKRNMIFACQDNYRPVRFLQCVKNPEHPSCRLNV

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    35-50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD38 is a multifunctional glycoprotein that plays a significant role in various physiological and pathological processes, including immune response, cell signaling, and calcium mobilization. It is predominantly expressed on the surface of immune cells, particularly lymphocytes, and is implicated in several diseases, such as cancer, autoimmune disorders, and chronic infections. The enzymatic activity of CD38, which includes NAD+ hydrolase and ADP-ribosyl cyclase functions, contributes to the generation of cyclic ADP-ribose, an important second messenger in calcium signaling. Given its critical roles, CD38 has emerged as a promising therapeutic target. The development of CD38 recombinant proteins facilitates the study of its structure, function, and interactions with ligands and inhibitors. Engineering CD38 into a recombinant form allows for a more detailed investigation of its biological activities, potential roles in cancer immunology, and the development of CD38-targeted therapies, such as monoclonal antibodies and small-molecule inhibitors. The ongoing research into CD38 recombinant proteins aims to harness their therapeutic potential while providing insights into the mechanisms underlying CD38-related pathologies. This line of research is crucial for advancing our understanding of immune regulation and developing novel treatments for diseases associated with CD38 dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US