Analytical Data
-
Gene name
PD-L2
-
简介
PD-L2 Protein plays a critical role in the T-cell costimulatory signal, fostering proliferation and IFNG production independently of PDCD1. While interacting with PDCD1 inhibits T-cell proliferation, PD-L2 itself intricately promotes immune responses. The dynamic interplay emphasizes PD-L2's dual role in either promoting or inhibiting T-cell activation within the immune signaling network, showcasing intricate regulatory mechanisms. PD-L2 Protein, Mouse (219a.a, HEK293, His) is the recombinant mouse-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Programmed cell death 1 ligand 2; PD-1 ligand 2; PD-L2; B7-DC; CD273
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9WUL5
-
Expression Region
L20-R219
-
AA Sequence
LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR
-
Protein Length
Extracellular Domain
-
Molecular Weight
31-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PD-L2 (Programmed Death-Ligand 2) is a crucial immune checkpoint protein that plays a significant role in modulating the immune response, particularly in the context of cancer and autoimmune diseases. As a ligand for the PD-1 receptor, PD-L2 helps to inhibit T-cell activation and proliferation, thereby contributing to immune tolerance and the prevention of excessive tissue damage. The understanding of PD-L2's function has become increasingly relevant with the rise of immunotherapy, where inhibiting PD-1 or its ligands can enhance the body's immune response against tumors. Research into PD-L2, particularly in the development of recombinant proteins, has gained momentum as scientists aim to elucidate its structural and functional properties, which can lead to novel therapeutic approaches. Recombinant PD-L2 proteins are being studied for their potential use as biomarkers for immune status, as well as their ability to serve as targets for antibody-based therapies. Additionally, investigating PD-L2 interactions may provide insight into the mechanisms of immune evasion in cancers, enabling the design of more effective immunotherapeutic strategies. Overall, the study of PD-L2 recombinant proteins is a promising area of research that can contribute significantly to advances in cancer treatment and the understanding of immune regulation.











