Cat: IPD-X19372

Recombinant Mouse 4-1BB/TNFRSF9 Protein(HEK293), His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    4-1BB/TNFRSF9

  • 简介

    4-1BB (CD137; TNFRSF9), a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. Mouse 4-1BB protein is a surface glycoprotein with a transmembrane domain. 4-1BB/TNFRSF9 Protein, Mouse (HEK293, His) is the extracellular part (V24-L187) of 4-1BB protein, produced by HEK293 cells with C-terminal His-tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tumor necrosis factor receptor superfamily member 9; CDw137; CD137; TNFRSF9; ILA

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P20334

  • Expression Region

    V24-L187

  • AA Sequence

    MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVL

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    19.00 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

4-1BB, also known as TNFRSF9, is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a crucial role in enhancing T cell activation and survival, making it a significant target for cancer immunotherapy. Research has shown that 4-1BB expression is upregulated on activated T cells, suggesting its involvement in the costimulatory signals that promote T cell proliferation and cytotoxic activity against tumor cells. The interest in 4-1BB as a therapeutic target has intensified with the development of recombinant proteins, including agonistic antibodies and fusion proteins, aimed at stimulating the 4-1BB signaling pathway to boost anti-tumor immune responses. Studies have indicated that targeting 4-1BB can lead to improved antitumor activity and prolonged survival in various preclinical models. Moreover, the combination of 4-1BB agonists with other immunotherapeutic agents, such as checkpoint inhibitors, has shown promise in enhancing overall treatment efficacy. Understanding the structural and functional dynamics of 4-1BB is essential for the rational design of these therapeutic agents. Consequently, ongoing research into the mechanisms of action, optimal dosing regimens, and potential synergies with existing treatments will be critical for translating findings into clinical applications, ultimately aiming to improve therapeutic outcomes for cancer patients.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US