Cat: IPD-X36011

Recombinant Human KIR2DL5/CD158f Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KIR2DL5/CD158f

  • 简介

    KIR2DL5/CD158f, present on NK cells, acts as a receptor for HLA-C alleles. Its inhibitory function finely tunes NK cell activity, preventing cell lysis by interacting with specific HLA-C molecules. This dynamic engagement contributes to the nuanced balance of inhibitory signals in the immune system, regulating NK cell responses to potential targets. KIR2DL5/CD158f Protein, Human (HEK293, Fc) is the recombinant human-derived KIR2DL5/CD158f protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Immobilized Human KIR2DL5 at 2 μg/mL (100 μL/well) can bind Anti- KIR2DL5 Antibody. The ED50 for this effect is 1.558 μg/mL. Immobilized Human KIR2DL5 at 2 μg/mL (100 μL/well) can bind Anti- KIR2DL5 Antibody. The ED50 for this effect is 1.558 μg/mL.

  • Alternative Names

    Killer cell immunoglobulin-like receptor 2DL5A; CD158f1; KIR2DL5A; CD158F

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q8N109

  • Expression Region

    H22-H240

  • AA Sequence

    HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH

  • Protein Length

    Partial

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KIR2DL5, also known as CD158f, is a member of the Killer Immunoglobulin-like Receptor (KIR) family, which plays a significant role in the regulation of immune responses. KIR2DL5 is primarily expressed on the surface of natural killer (NK) cells and has been implicated in the recognition of target cells, influencing the activation and inhibition of NK cell functions. The investigation of KIR2DL5/CD158f is particularly relevant in the context of its potential involvement in immune evasion by tumors and pathogens, as well as its impact on graft-versus-host disease in transplant settings. Understanding the precise molecular mechanisms by which KIR2DL5 interacts with its ligands and modulates NK cell activity is crucial for the development of immunotherapies and novel treatment strategies for various diseases, including cancers and viral infections. Additionally, the generation of recombinant KIR2DL5 proteins is essential for functional studies, enabling researchers to analyze receptor-ligand interactions and the downstream signaling pathways triggered upon activation. The advancement of this research could lead to improved therapeutic approaches that enhance NK cell responses in oncology and transplantation, thereby offering new avenues for patient management and treatment outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US