Cat: IPD-X35788

Recombinant Human DLL3 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DLL3

  • 简介

    Delta-like protein 3/DLL3 stands out as a key regulator of neurogenesis and cell differentiation. As an inhibitor of primary neurogenesis, DLL3 plays a crucial role in guiding neurons along specific differentiation pathways. Delta-like protein 3/DLL3 Protein, Human (Biotinylated, HEK293, His) is the recombinant human-derived Delta-like protein 3/DLL3 protein, expressed by HEK293 , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Delta3; DLL3; Pudgy; SCDO1; SCDO1delta3

  • Species

    Human

  • Source

    HEK293

  • Tag

    N-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NYJ7-1

  • Expression Region

    A27-R490

  • AA Sequence

    AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    52-62 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DLL3 (Delta-like ligand 3) is a member of the Notch signaling pathway, primarily involved in cell differentiation and development. Its expression is notably restricted to certain neuroendocrine tumors, particularly small cell lung cancer (SCLC), making it a potential target for therapeutic interventions. Research has revealed that DLL3 acts as an oncofetal antigen, which is abundantly expressed in tumor cells while being minimally present in normal tissue. This unique expression pattern has prompted investigations into DLL3 as a biomarker for diagnosis and a target for targeted therapies, such as antibody-drug conjugates. Recombinant DLL3 protein has been essential for these studies, enabling the development of assays to measure DLL3 expression and facilitating the exploration of DLL3-targeted therapeutic strategies. Understanding the functional role of DLL3 in tumor biology and its potential implications in therapeutic context is crucial for advancing cancer treatment, especially for aggressive malignancies like SCLC. Therefore, ongoing research aims not only to elucidate the biological functions of DLL3 but also to evaluate its efficacy as a target for novel cancer therapies, including immunotherapy approaches, enhancing the hope for improved clinical outcomes in patients with DLL3-expressing tumors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US